HACE1 Antikörper (Middle Region)
-
- Target Alle HACE1 Antikörper anzeigen
- HACE1 (HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HACE1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HACE1 antibody was raised against the middle region of HACE1
- Aufreinigung
- Affinity purified
- Immunogen
- HACE1 antibody was raised using the middle region of HACE1 corresponding to a region with amino acids DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV
- Top Product
- Discover our top product HACE1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HACE1 Blocking Peptide, catalog no. 33R-2223, is also available for use as a blocking control in assays to test for specificity of this HACE1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HACE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HACE1 (HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1))
- Andere Bezeichnung
- HACE1 (HACE1 Produkte)
- Synonyme
- HACE1 antikoerper, 1700042J16Rik antikoerper, A730034A22Rik antikoerper, BC025474 antikoerper, HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1 antikoerper, HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1 L homeolog antikoerper, HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1 antikoerper, HACE1 antikoerper, hace1 antikoerper, hace1.L antikoerper, Hace1 antikoerper
- Hintergrund
- HACE1 contains 6 ANK repeats and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. HACE1 is an E3 ubiquitin-protein ligase that may function in cellular proteins degradation.
- Molekulargewicht
- 102 kDa (MW of target protein)
-