MYLIP Antikörper (Middle Region)
-
- Target Alle MYLIP Antikörper anzeigen
- MYLIP (Myosin Regulatory Light Chain Interacting Protein (MYLIP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MYLIP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MYLIP antibody was raised against the middle region of MYLIP
- Aufreinigung
- Affinity purified
- Immunogen
- MYLIP antibody was raised using the middle region of MYLIP corresponding to a region with amino acids CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE
- Top Product
- Discover our top product MYLIP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MYLIP Blocking Peptide, catalog no. 33R-1817, is also available for use as a blocking control in assays to test for specificity of this MYLIP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYLIP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MYLIP (Myosin Regulatory Light Chain Interacting Protein (MYLIP))
- Andere Bezeichnung
- MYLIP (MYLIP Produkte)
- Synonyme
- IDOL antikoerper, MIR antikoerper, 9430057C20Rik antikoerper, Mir antikoerper, mylip antikoerper, wu:fj36b03 antikoerper, zgc:55987 antikoerper, MYLIP antikoerper, mir antikoerper, zgc:153767 antikoerper, myosin regulatory light chain interacting protein antikoerper, myosin regulatory light chain interacting protein a antikoerper, myosin regulatory light chain interacting protein L homeolog antikoerper, myosin regulatory light chain interacting protein b antikoerper, MYLIP antikoerper, Mylip antikoerper, mylipa antikoerper, mylip.L antikoerper, mylip antikoerper, mylipb antikoerper
- Hintergrund
- The ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowth.
- Molekulargewicht
- 50 kDa (MW of target protein)
-