DSTYK Antikörper (Middle Region)

Produktnummer ABIN631202

Produktdetails anti-DSTYK Antikörper

Target: DSTYK (Dual serine/threonine and tyrosine Protein Kinase (DSTYK))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DSTYK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RIPK5 antibody was raised against the middle region of RIPK5

Aufreinigung: Affinity purified

Immunogen: RIPK5 antibody was raised using the middle region of RIPK5 corresponding to a region with amino acids EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RIPK5 Blocking Peptide, catalog no. 33R-2341, is also available for use as a blocking control in assays to test for specificity of this RIPK5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIPK5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DSTYK

Target: DSTYK (Dual serine/threonine and tyrosine Protein Kinase (DSTYK))

Andere Bezeichnung: RIPK5 (DSTYK Produkte)

Synonyme: CAKUT1 antikoerper, DustyPK antikoerper, RIP5 antikoerper, RIPK5 antikoerper, A930019K20Rik antikoerper, C430014H23Rik antikoerper, C820013G01 antikoerper, Ripk5 antikoerper, ripk5 antikoerper, zgc:136421 antikoerper, DSTYK antikoerper, GB11994 antikoerper, DUSTYPK antikoerper, dual serine/threonine and tyrosine protein kinase antikoerper, receptor interacting protein kinase 5 antikoerper, dual serine/threonine and tyrosine protein kinase S homeolog antikoerper, DSTYK antikoerper, Dstyk antikoerper, dstyk antikoerper, Ripk5 antikoerper, dstyk.S antikoerper

Hintergrund: RIPK5 may induce both caspase-dependent apoptosis and caspase-independent cell death.

Molekulargewicht: 100 kDa (MW of target protein)