MTPN Antikörper (Middle Region)
-
- Target Alle MTPN Antikörper anzeigen
- MTPN (Myotrophin (MTPN))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MTPN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Myotrophin antibody was raised against the middle region of MTPN
- Aufreinigung
- Affinity purified
- Immunogen
- Myotrophin antibody was raised using the middle region of MTPN corresponding to a region with amino acids GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV
- Top Product
- Discover our top product MTPN Primärantikörper
-
anti-Myotrophin (MTPN) (AA 1-118) antibody
MTPN Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 1F3 unconjugated
anti-Myotrophin (MTPN) (AA 1-118) antibodyMTPN Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Myotrophin (MTPN) (AA 35-84) antibodyMTPN Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Kaninchen, Meerschweinchen, Zebrafisch (Danio rerio), Pferd, Affe, Fledermaus, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Myotrophin (MTPN) (AA 2-118) antibodyMTPN Reaktivität: Maus WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Myotrophin (MTPN) (Middle Region) antibodyMTPN Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Kaninchen, Meerschweinchen, Zebrafisch (Danio rerio), Pferd WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Myotrophin Blocking Peptide, catalog no. 33R-3534, is also available for use as a blocking control in assays to test for specificity of this Myotrophin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTPN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTPN (Myotrophin (MTPN))
- Andere Bezeichnung
- Myotrophin (MTPN Produkte)
- Synonyme
- MGC76285 antikoerper, GCDP antikoerper, V-1 antikoerper, Gcdp antikoerper, wu:fa10f07 antikoerper, zgc:64078 antikoerper, 5033418D15Rik antikoerper, V1 antikoerper, myotrophin antikoerper, myotrophin S homeolog antikoerper, mtpn antikoerper, MTPN antikoerper, Mtpn antikoerper, mtpn.S antikoerper
- Hintergrund
- MTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy.
- Molekulargewicht
- 13 kDa (MW of target protein)
-
