PCDH17 Antikörper (C-Term)

Produktnummer ABIN631153

Produktdetails anti-PCDH17 Antikörper

Target: PCDH17 (Protocadherin 17 (PCDH17))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDH17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCDH17 antibody was raised against the C terminal of PCDH17

Aufreinigung: Affinity purified

Immunogen: PCDH17 antibody was raised using the C terminal of PCDH17 corresponding to a region with amino acids SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDH17 Blocking Peptide, catalog no. 33R-8394, is also available for use as a blocking control in assays to test for specificity of this PCDH17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCDH17

Target: PCDH17 (Protocadherin 17 (PCDH17))

Andere Bezeichnung: PCDH17 (PCDH17 Produkte)

Synonyme: PCDH68 antikoerper, PCH68 antikoerper, C030033F14Rik antikoerper, Gm78 antikoerper, protocadherin 17 antikoerper, PCDH17 antikoerper, Pcdh17 antikoerper

Hintergrund: PCDH17 contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins.It may play a role in the establishment and function of specific cell-cell connections in the brain.

Molekulargewicht: 124 kDa (MW of target protein)