HPD Antikörper (Middle Region)
-
- Target Alle HPD Antikörper anzeigen
- HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HPD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HPD antibody was raised against the middle region of HPD
- Aufreinigung
- Affinity purified
- Immunogen
- HPD antibody was raised using the middle region of HPD corresponding to a region with amino acids EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV
- Top Product
- Discover our top product HPD Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HPD Blocking Peptide, catalog no. 33R-2584, is also available for use as a blocking control in assays to test for specificity of this HPD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HPD (4-Hydroxyphenylpyruvate Dioxygenase (HPD))
- Andere Bezeichnung
- HPD (HPD Produkte)
- Synonyme
- fb58f02 antikoerper, hpd antikoerper, wu:fb58f02 antikoerper, zgc:56326 antikoerper, zgc:92456 antikoerper, MGC146689 antikoerper, BA0240 antikoerper, PSPTO3553 antikoerper, DDBDRAFT_0203373 antikoerper, DDBDRAFT_0231603 antikoerper, DDBDRAFT_0231604 antikoerper, DDB_0203373 antikoerper, DDB_0231603 antikoerper, DDB_0231604 antikoerper, hppd antikoerper, 4-HPPD antikoerper, 4HPPD antikoerper, GLOD3 antikoerper, HPPDASE antikoerper, PPD antikoerper, 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE antikoerper, F12K11.9 antikoerper, F12K11_9 antikoerper, HPD antikoerper, P-HYDROXYPHENYLPYRUVATE DIOXYGENASE antikoerper, phytoene desaturation 1 antikoerper, Fla antikoerper, Flp antikoerper, Hppd antikoerper, Laf antikoerper, 4-hydroxyphenylpyruvate dioxygenase a antikoerper, 4-hydroxyphenylpyruvate dioxygenase antikoerper, 4-hydroxyphenylpyruvate dioxygenase b antikoerper, 4-hydroxyphenylpyruvate dioxygenase L homeolog antikoerper, 4-hydroxyphenylpyruvic acid dioxygenase antikoerper, hpda antikoerper, HPD antikoerper, hpdb antikoerper, hpd.L antikoerper, hpd antikoerper, BA_0240 antikoerper, hppD antikoerper, Hpd antikoerper, PDS1 antikoerper
- Hintergrund
- The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria.
- Molekulargewicht
- 45 kDa (MW of target protein)
-