MPST Antikörper (Middle Region)

Produktnummer ABIN631061

Produktdetails anti-MPST Antikörper

Target: MPST (Mercaptopyruvate Sulfurtransferase (MPST))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPST Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MPST antibody was raised against the middle region of MPST

Aufreinigung: Affinity purified

Immunogen: MPST antibody was raised using the middle region of MPST corresponding to a region with amino acids DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MPST Blocking Peptide, catalog no. 33R-2094, is also available for use as a blocking control in assays to test for specificity of this MPST antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPST antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MPST

Target: MPST (Mercaptopyruvate Sulfurtransferase (MPST))

Andere Bezeichnung: MPST (MPST Produkte)

Synonyme: MST antikoerper, TST2 antikoerper, Mst antikoerper, mst antikoerper, tst antikoerper, tst2 antikoerper, fa96h11 antikoerper, mpst antikoerper, wu:fa96h11 antikoerper, mercaptopyruvate sulfurtransferase antikoerper, zgc:162544 antikoerper, mercaptopyruvate sulfurtransferase L homeolog antikoerper, mercaptopyruvate sulfurtransferase S homeolog antikoerper, MPST antikoerper, Mpst antikoerper, mpst antikoerper, zgc:162544 antikoerper, sseA antikoerper, mpst.L antikoerper, mpst.S antikoerper

Hintergrund: MPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis.

Molekulargewicht: 33 kDa (MW of target protein)