PNPLA8 Antikörper (Middle Region)

Produktnummer ABIN630834

Produktdetails anti-PNPLA8 Antikörper

Target: PNPLA8 (Patatin-Like phospholipase Domain Containing 8 (PNPLA8))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PNPLA8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PNPLA8 antibody was raised against the middle region of PNPLA8

Aufreinigung: Affinity purified

Immunogen: PNPLA8 antibody was raised using the middle region of PNPLA8 corresponding to a region with amino acids IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PNPLA8 Blocking Peptide, catalog no. 33R-3926, is also available for use as a blocking control in assays to test for specificity of this PNPLA8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PNPLA8

Target: PNPLA8 (Patatin-Like phospholipase Domain Containing 8 (PNPLA8))

Andere Bezeichnung: PNPLA8 (PNPLA8 Produkte)

Synonyme: IPLA2(GAMMA) antikoerper, IPLA2-2 antikoerper, IPLA2G antikoerper, iPLA2gamma antikoerper, 1200006O19Rik antikoerper, AI467579 antikoerper, Ipla2(gamma) antikoerper, RGD1311444 antikoerper, iPLA2 antikoerper, patatin like phospholipase domain containing 8 antikoerper, patatin-like phospholipase domain containing 8 antikoerper, PNPLA8 antikoerper, Pnpla8 antikoerper

Hintergrund: Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors.

Molekulargewicht: 88 kDa (MW of target protein)