SPDYA Antikörper
-
- Target Alle SPDYA Antikörper anzeigen
- SPDYA (Speedy Homolog A (SPDYA))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SPDYA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SPDYA antibody was raised using a synthetic peptide corresponding to a region with amino acids MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNT
- Top Product
- Discover our top product SPDYA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SPDYA Blocking Peptide, catalog no. 33R-6362, is also available for use as a blocking control in assays to test for specificity of this SPDYA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPDYA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPDYA (Speedy Homolog A (SPDYA))
- Andere Bezeichnung
- SPDYA (SPDYA Produkte)
- Synonyme
- zgc:101624 antikoerper, 4921517J08Rik antikoerper, 4930548B21Rik antikoerper, GS4 antikoerper, MLZ-465 antikoerper, Spdy1 antikoerper, RINGO antikoerper, SPDY1 antikoerper, RINGO3 antikoerper, RINGOA antikoerper, SPY1 antikoerper, Gs4 antikoerper, Lm23 antikoerper, Spy1 antikoerper, speedy homolog A (Xenopus laevis) antikoerper, speedy/RINGO cell cycle regulator family member A antikoerper, speedy/RINGO cell cycle regulator family, member A antikoerper, SPDYA antikoerper, spdya antikoerper, Spdya antikoerper
- Hintergrund
- SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.
- Molekulargewicht
- 36 kDa (MW of target protein)
-