Septin 9 Antikörper (C-Term)
-
- Target Alle Septin 9 (SEPT9) Antikörper anzeigen
- Septin 9 (SEPT9)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Septin 9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Septin 9 antibody was raised against the C terminal of 40430
- Aufreinigung
- Affinity purified
- Immunogen
- Septin 9 antibody was raised using the C terminal of 40430 corresponding to a region with amino acids HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK
- Top Product
- Discover our top product SEPT9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40057 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Septin 9 (SEPT9)
- Andere Bezeichnung
- Septin 9 (SEPT9 Produkte)
- Synonyme
- SEPT9 antikoerper, msf antikoerper, msf1 antikoerper, napb antikoerper, sint1 antikoerper, pnutl4 antikoerper, septd1 antikoerper, af17q25 antikoerper, septin-9 antikoerper, AF17q25 antikoerper, MSF antikoerper, MSF1 antikoerper, NAPB antikoerper, PNUTL4 antikoerper, SINT1 antikoerper, SeptD1 antikoerper, Msf antikoerper, Sint1 antikoerper, Eseptin antikoerper, Slpa antikoerper, cb999 antikoerper, fb02h06 antikoerper, sept9 antikoerper, wu:fb02h06 antikoerper, septin 9 antikoerper, septin-9 antikoerper, septin 9 S homeolog antikoerper, septin 9a antikoerper, SEPT9 antikoerper, sept9 antikoerper, LOC100605286 antikoerper, sept9.S antikoerper, Sept9 antikoerper, sept9a antikoerper
- Hintergrund
- Septin-9 is a member of the septin family, which contains cytoplasmic cytoskeletal filament-forming proteins that have a conserved GTP-binding domain.
- Molekulargewicht
- 37 kDa (MW of target protein)
-