CRYGC Antikörper (Middle Region)

Produktnummer ABIN630603

Produktdetails anti-CRYGC Antikörper

Target: CRYGC (Crystallin, gamma C (CRYGC))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRYGC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Crystallin Gamma C antibody was raised against the middle region of CRYGC

Aufreinigung: Affinity purified

Immunogen: Crystallin Gamma C antibody was raised using the middle region of CRYGC corresponding to a region with amino acids GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Crystallin Gamma C Blocking Peptide, catalog no. 33R-3422, is also available for use as a blocking control in assays to test for specificity of this Crystallin Gamma C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYGC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRYGC

Target: CRYGC (Crystallin, gamma C (CRYGC))

Andere Bezeichnung: Crystallin gamma C (CRYGC Produkte)

Synonyme: Cryg antikoerper, Cryg3 antikoerper, Len antikoerper, CCL antikoerper, CRYG3 antikoerper, CTRCT2 antikoerper, Cryg-5 antikoerper, ccl antikoerper, cryg3 antikoerper, MGC84008 antikoerper, CRYGC antikoerper, crystallin, gamma C antikoerper, crystallin gamma C antikoerper, crystallin gamma C L homeolog antikoerper, gamma-crystallin C antikoerper, Crygc antikoerper, CRYGC antikoerper, crygc.L antikoerper, LOC100069179 antikoerper

Hintergrund: Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families, Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation.

Molekulargewicht: 21 kDa (MW of target protein)