SQLE Antikörper (C-Term)

Produktnummer ABIN630528

Produktdetails anti-SQLE Antikörper

Target: SQLE (Squalene Epoxidase (SQLE))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SQLE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SQLE antibody was raised against the C terminal of SQLE

Aufreinigung: Affinity purified

Immunogen: SQLE antibody was raised using the C terminal of SQLE corresponding to a region with amino acids KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SQLE Blocking Peptide, catalog no. 33R-4493, is also available for use as a blocking control in assays to test for specificity of this SQLE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SQLE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SQLE

Target: SQLE (Squalene Epoxidase (SQLE))

Andere Bezeichnung: SQLE (SQLE Produkte)

Synonyme: An03g03770 antikoerper, AO090701000685 antikoerper, AI323792 antikoerper, squalene epoxidase antikoerper, SQLE antikoerper, ANI_1_450034 antikoerper, AOR_1_1218114 antikoerper, CC1G_03987 antikoerper, BDBG_08449 antikoerper, MCYG_02365 antikoerper, TERG_05717 antikoerper, Sqle antikoerper

Hintergrund: Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.

Molekulargewicht: 39 kDa (MW of target protein)