Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8) Antikörper

Antigen: Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8)

Synonyme: LAT2, LPI-PC1, Lat2, Lat4, si:zc14a17.3, si:ch211-14a17.3, XAA2, MGC52933, lat2, lpi-pc1, MGC75862, 4F2LC-5, DKFZp459J1228, AA408822

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN630365

Produktbeschreibung

Weitere Bezeichnung: SLC7A8

Immunogen: SLC7A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

Beschreibung: SLC7A8 is sodium-independent, high-affinity transport of large neutral amino acids. It has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. SLC7A8 also plays a role in basolateral (re)absorption of neutral amino acids.

Molekulargewicht: 37 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Total IgG Protein A purified

Buffer: Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC7A8 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Beschränkungen: Nur für Forschungszwecke einsetzbar