NSDHL Antikörper

Produktnummer ABIN630356

Produktdetails anti-NSDHL Antikörper

Target: NSDHL (NAD(P) Dependent Steroid Dehydrogenase-Like (NSDHL))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NSDHL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: NSDHL antibody was raised using a synthetic peptide corresponding to a region with amino acids RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NSDHL Blocking Peptide, catalog no. 33R-7828, is also available for use as a blocking control in assays to test for specificity of this NSDHL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSDHL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NSDHL

Target: NSDHL (NAD(P) Dependent Steroid Dehydrogenase-Like (NSDHL))

Andere Bezeichnung: NSDHL (NSDHL Produkte)

Synonyme: zgc:112474 antikoerper, H105E3 antikoerper, SDR31E1 antikoerper, XAP104 antikoerper, AI747449 antikoerper, Bpa antikoerper, Str antikoerper, NAD(P) dependent steroid dehydrogenase-like antikoerper, NAD(P) dependent steroid dehydrogenase-like L homeolog antikoerper, NSDHL antikoerper, nsdhl antikoerper, nsdhl.L antikoerper, Nsdhl antikoerper

Hintergrund: NSDHL is localized in the endoplasmic reticulum and is involved in cholesterol biosynthesis. Mutations in NSDHL gene are associated with CHILD syndrome, which is a X-linked dominant disorder of lipid metabolism with disturbed cholesterol biosynthesis, and typically lethal in males.

Molekulargewicht: 42 kDa (MW of target protein)