In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

ATP-Binding Cassette, Sub-Family G (WHITE), Member 2 (ABCG2) Antikörper

Antigen

ATP-Binding Cassette, Sub-Family G (WHITE), Member 2 (ABCG2)

Synonyme MRX, MXR, ABCP, BCRP, BMDP, MXR1, ABC15, BCRP1, CD338, CDw338, EST157481, MGC102821, Bcrp1, AI428558, ABCG2, MGC127688, bcrp
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Immunhistochemie (IHC), Western Blot (WB)
Produktnummer ABIN630346
Menge 100 ug  (1 mg/ml)  (Varianten)
Preis 376,65 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung ABCG2
Immunogen ABCG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDP
Beschreibung ABCG2 is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue.
Molekulargewicht 72 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ABCG2 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Transporter
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "ATP-Binding Cassette, Sub-Family G (WHITE), Member 2 (ABCG2)", Typ "Antikörper" finden
Wirte Maus (43), Kaninchen (38), Ratte (5)
Reaktivitäten Human (78), Maus (30), Ratte (Rattus) (18), Rind (Kuh) (4), Hund (3), Affe (3), Schwein (2), Huhn (1), Escherichia Coli (E. Coli) (1)
Applikationen Durchflusszytometrie (FACS) (53), Western Blot (WB) (43), Immunfluoreszenz (IF) (32), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (21), Immunhistochemie (Paraffinschnitte) (IHC (p)) (12), ELISA (8), Enzyme Immunoassay (EIA) (6), Immunzytochemie (ICC) (3), Immunhistochemie (IHC) (3), ELISA (Detektionsantikörper) (2), Immunhistochemie (formalinfixierte Schnitte) (IHC (f)) (2), Immunpräzipitation (IP) (2), Dot Blot (Dot) (1), Funktionale Studien (Func) (1), Immunoelectron Microscopy (IEM) (1)
Konjugate Biotin (6), PE (6), FITC (3), APC (1), Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), Gold (1), HRP (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)
Epitope C-Term (2), Center (2)