Reticulon 2 Antikörper (N-Term)
-
- Target Alle Reticulon 2 (RTN2) Antikörper anzeigen
- Reticulon 2 (RTN2)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Reticulon 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- RTN2 antibody was raised against the N terminal of RTN2
- Aufreinigung
- Purified
- Immunogen
- RTN2 antibody was raised using the N terminal of RTN2 corresponding to a region with amino acids MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE
- Top Product
- Discover our top product RTN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RTN2 Blocking Peptide, catalog no. 33R-6064, is also available for use as a blocking control in assays to test for specificity of this RTN2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Reticulon 2 (RTN2)
- Andere Bezeichnung
- RTN2 (RTN2 Produkte)
- Synonyme
- rtn2 antikoerper, RTN2 antikoerper, nsp2 antikoerper, nspl1 antikoerper, xrtn2 antikoerper, RTN2-A antikoerper, TTpA048i08 antikoerper, NSP2 antikoerper, NSPL1 antikoerper, NSPLI antikoerper, SPG12 antikoerper, RTN2-B antikoerper, RTN2-C antikoerper, MMS10-P antikoerper, Ms10p antikoerper, Nspl1 antikoerper, reticulon 2 antikoerper, reticulon-2 antikoerper, reticulon 2 L homeolog antikoerper, reticulon 2 (Z-band associated protein) antikoerper, rtn2 antikoerper, RTN2 antikoerper, LOC484444 antikoerper, Rtn2 antikoerper, rtn2.L antikoerper
- Hintergrund
- This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.
- Molekulargewicht
- 51 kDa (MW of target protein)
-