LNX1 Antikörper (C-Term)

Produktnummer ABIN630139

Produktdetails anti-LNX1 Antikörper

Target: LNX1 (Ligand of Numb-Protein X 1 (LNX1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LNX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LNX1 antibody was raised against the C terminal of LNX1

Aufreinigung: Purified

Immunogen: LNX1 antibody was raised using the C terminal of LNX1 corresponding to a region with amino acids SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LNX1 Blocking Peptide, catalog no. 33R-8514, is also available for use as a blocking control in assays to test for specificity of this LNX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LNX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LNX1

Target: LNX1 (Ligand of Numb-Protein X 1 (LNX1))

Andere Bezeichnung: LNX1 (LNX1 Produkte)

Synonyme: LNX1 antikoerper, fj78f06 antikoerper, lnx antikoerper, si:dkey-12h2.1 antikoerper, wu:fj78f06 antikoerper, zgc:152906 antikoerper, Lnx antikoerper, LNX antikoerper, MPDZ antikoerper, PDZRN2 antikoerper, ligand of numb-protein X 1 antikoerper, LNX1 antikoerper, lnx1 antikoerper, Lnx1 antikoerper

Hintergrund: LNX1 is a membrane-bound protein that is involved in signal transduction and protein interactions. LNX1 is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis.

Molekulargewicht: 70 kDa (MW of target protein)