KCNK3 Antikörper (C-Term)
-
- Target Alle KCNK3 Antikörper anzeigen
- KCNK3 (Potassium Channel, Subfamily K, Member 3 (KCNK3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Ratte, Maus, Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNK3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNK3 antibody was raised against the C terminal of KCNK3
- Aufreinigung
- Purified
- Immunogen
- KCNK3 antibody was raised using the C terminal of KCNK3 corresponding to a region with amino acids TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL
- Top Product
- Discover our top product KCNK3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNK3 Blocking Peptide, catalog no. 33R-9002, is also available for use as a blocking control in assays to test for specificity of this KCNK3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNK3 (Potassium Channel, Subfamily K, Member 3 (KCNK3))
- Andere Bezeichnung
- KCNK3 (KCNK3 Produkte)
- Synonyme
- si:dkey-164m15.1 antikoerper, K2p3.1 antikoerper, OAT1 antikoerper, PPH4 antikoerper, TASK antikoerper, TASK-1 antikoerper, TBAK1 antikoerper, cTBAK-1 antikoerper, Task-1 antikoerper, rTASK antikoerper, KCNK3 antikoerper, potassium channel, subfamily K, member 3a antikoerper, potassium two pore domain channel subfamily K member 3 antikoerper, potassium channel, subfamily K, member 3 antikoerper, kcnk3a antikoerper, KCNK3 antikoerper, Kcnk3 antikoerper
- Hintergrund
- KCNK3 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The gene product is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene.
- Molekulargewicht
- 43 kDa (MW of target protein)
-