RPL32 Antikörper (N-Term)

Produktnummer ABIN630044

Produktdetails anti-RPL32 Antikörper

Target: RPL32 (Ribosomal Protein L32 (RPL32))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL32 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPL32 antibody was raised against the N terminal of RPL32

Aufreinigung: Purified

Immunogen: RPL32 antibody was raised using the N terminal of RPL32 corresponding to a region with amino acids AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL32 Blocking Peptide, catalog no. 33R-1035, is also available for use as a blocking control in assays to test for specificity of this RPL32 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL32 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL32

Target: RPL32 (Ribosomal Protein L32 (RPL32))

Andere Bezeichnung: RPL32 (RPL32 Produkte)

Synonyme: L32 antikoerper, AU020185 antikoerper, rpL32-3A antikoerper, zgc:136952 antikoerper, 143250_at antikoerper, BcDNA:RH03940 antikoerper, CG7939 antikoerper, Dmel\\CG7939 antikoerper, M(3)99D antikoerper, RP-49 antikoerper, RP49 antikoerper, RPL32 antikoerper, Rp-49 antikoerper, Rp49 antikoerper, Rp49/RpL32 antikoerper, Rpl32 antikoerper, bs30a02.y1 antikoerper, rp49 antikoerper, rp49/RpL32 antikoerper, ribosomal protein L32 antikoerper, 50S ribosomal protein L32 antikoerper, rpl32 antikoerper, ribosomal protein L32 L homeolog antikoerper, Ribosomal protein L32 antikoerper, ribosomal protein L32 homolog32 antikoerper, RPL32 antikoerper, rpl32 antikoerper, Rpl32 antikoerper, rpl32.L antikoerper, RpL32 antikoerper

Hintergrund: RPL32 is a ribosomal protein that is a component of the 60S subunit. RPL32 belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Molekulargewicht: 15 kDa (MW of target protein)