NXF5 Antikörper (Middle Region)

Produktnummer ABIN629931

Produktdetails anti-NXF5 Antikörper

Target: NXF5 (Nuclear RNA Export Factor 5 (NXF5))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NXF5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: NXF5 antibody was raised against the middle region of NXF5

Aufreinigung: Purified

Immunogen: NXF5 antibody was raised using the middle region of NXF5 corresponding to a region with amino acids ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NXF5 Blocking Peptide, catalog no. 33R-4173, is also available for use as a blocking control in assays to test for specificity of this NXF5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NXF5

Target: NXF5 (Nuclear RNA Export Factor 5 (NXF5))

Andere Bezeichnung: NXF5 (NXF5 Produkte)

Synonyme: NXF2B antikoerper, nuclear RNA export factor 5 antikoerper, nuclear RNA export factor 2 antikoerper, NXF5 antikoerper, LOC609849 antikoerper, Nxf5 antikoerper

Hintergrund: NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.

Molekulargewicht: 44 kDa (MW of target protein)