NXF5 Antikörper (Middle Region)
-
- Target Alle NXF5 Antikörper anzeigen
- NXF5 (Nuclear RNA Export Factor 5 (NXF5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NXF5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- NXF5 antibody was raised against the middle region of NXF5
- Aufreinigung
- Purified
- Immunogen
- NXF5 antibody was raised using the middle region of NXF5 corresponding to a region with amino acids ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE
- Top Product
- Discover our top product NXF5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NXF5 Blocking Peptide, catalog no. 33R-4173, is also available for use as a blocking control in assays to test for specificity of this NXF5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXF5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NXF5 (Nuclear RNA Export Factor 5 (NXF5))
- Andere Bezeichnung
- NXF5 (NXF5 Produkte)
- Synonyme
- NXF2B antikoerper, nuclear RNA export factor 5 antikoerper, nuclear RNA export factor 2 antikoerper, NXF5 antikoerper, LOC609849 antikoerper, Nxf5 antikoerper
- Hintergrund
- NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.
- Molekulargewicht
- 44 kDa (MW of target protein)
-