RBCK1 Antikörper (Middle Region)
-
- Target Alle RBCK1 Antikörper anzeigen
- RBCK1 (RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RBCK1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C20 ORF18 antibody was raised against the middle region of C20 rf18
- Aufreinigung
- Purified
- Immunogen
- C20 ORF18 antibody was raised using the middle region of C20 rf18 corresponding to a region with amino acids AYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRS
- Top Product
- Discover our top product RBCK1 Primärantikörper
-
anti-RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1) (AA 3-99) antibody
RBCK1 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 3C3 unconjugated
anti-RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1) antibodyRBCK1 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1) (AA 1-230) antibodyRBCK1 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1) (N-Term) antibodyRBCK1 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1) (AA 1-30), (N-Term) antibodyRBCK1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB42651 unconjugated
anti-RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1) antibodyRBCK1 Reaktivität: Human WB, IHC (p) Wirt: Maus Monoclonal CL4289 unconjugated
anti-RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1) (AA 162-261) antibodyRBCK1 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1) (AA 251-350) antibodyRBCK1 Reaktivität: Maus WB, ELISA, IF (cc), IF (p), IHC (p), ICC, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1) antibodyRBCK1 Reaktivität: Human WB Wirt: Maus Monoclonal 1839CT718-19-54 unconjugated
anti-RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1) (AA 16-46), (N-Term) antibodyRBCK1 Reaktivität: Human IHC (p) Wirt: Kaninchen Polyclonal RB4113 unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C20ORF18 Blocking Peptide, catalog no. 33R-1633, is also available for use as a blocking control in assays to test for specificity of this C20ORF18 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF18 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBCK1 (RanBP-Type and C3HC4-Type Zinc Finger Containing 1 (RBCK1))
- Andere Bezeichnung
- C20ORF18 (RBCK1 Produkte)
- Synonyme
- RBCK1 antikoerper, C20orf18 antikoerper, HOIL-1 antikoerper, HOIL1 antikoerper, RBCK2 antikoerper, RNF54 antikoerper, UBCE7IP3 antikoerper, XAP3 antikoerper, XAP4 antikoerper, ZRANB4 antikoerper, C20ORF18 antikoerper, AL033326 antikoerper, HOIL-1L antikoerper, UIP28 antikoerper, Ubce7ip3 antikoerper, Pkcbpb15 antikoerper, zgc:91964 antikoerper, SHANK-associated RH domain interactor antikoerper, RANBP2-type and C3HC4-type zinc finger containing 1 antikoerper, ranBP-type and C3HC4-type zinc finger-containing protein 1 antikoerper, RanBP-type and C3HC4-type zinc finger containing 1 antikoerper, SHARPIN antikoerper, RBCK1 antikoerper, LOC100411512 antikoerper, Rbck1 antikoerper, rbck1 antikoerper
- Hintergrund
- C20orf18 is similar to mouse UIP28/UbcM4 interacting protein.
- Molekulargewicht
- 51 kDa (MW of target protein)
-
