GMPR2 Antikörper (C-Term)

Produktnummer ABIN629588

Produktdetails anti-GMPR2 Antikörper

Target: GMPR2 (Guanosine Monophosphate Reductase 2 (GMPR2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GMPR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GMPR2 antibody was raised against the C terminal of GMPR2

Aufreinigung: Purified

Immunogen: GMPR2 antibody was raised using the C terminal of GMPR2 corresponding to a region with amino acids GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GMPR2 Blocking Peptide, catalog no. 33R-3152, is also available for use as a blocking control in assays to test for specificity of this GMPR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GMPR2

Target: GMPR2 (Guanosine Monophosphate Reductase 2 (GMPR2))

Andere Bezeichnung: GMPR2 (GMPR2 Produkte)

Synonyme: MGC81876 antikoerper, wu:fb63f02 antikoerper, zgc:136869 antikoerper, 1810008P16Rik antikoerper, 5730544D12Rik antikoerper, AA959850 antikoerper, guanosine monophosphate reductase 2 S homeolog antikoerper, guanosine monophosphate reductase 2 antikoerper, gmpr2.S antikoerper, guaC antikoerper, gmpr2 antikoerper, GMPR2 antikoerper, Gmpr2 antikoerper

Hintergrund: GMPR2 catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. It plays a role in modulating cellular differentiation.

Molekulargewicht: 20 kDa (MW of target protein)