Relaxin 1 Antikörper

Produktnummer ABIN5519057

Produktdetails anti-Relaxin 1 Antikörper

Target: Relaxin 1 (RLN1)

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Relaxin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Relaxin 1 detection. Tested with WB, IHC-P in Human,Rat.

Sequenz: VAAKWKDDVI KLCGRELVRA QIAICGMSTW S

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Relaxin 1 detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: relaxin 1
Protein Name: Prorelaxin H1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human Relaxin 1 (VAAKWKDDVIKLCGRELVRAQIAICGMSTWS).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Relaxin 1

Target: Relaxin 1 (RLN1)

Andere Bezeichnung: RLN1 (RLN1 Produkte)

Synonyme: H1 antikoerper, H1RLX antikoerper, RLXH1 antikoerper, bA12D24.3.1 antikoerper, bA12D24.3.2 antikoerper, Rln antikoerper, rlx antikoerper, RELAX antikoerper, RLX1 antikoerper, RNL1 antikoerper, RLN1 antikoerper, RLX antikoerper, relaxin 1 antikoerper, RLN1 antikoerper, Rln1 antikoerper

Hintergrund: Relaxin 1 is a member of relaxin-like peptide family. Relaxin gene maps to human chromosome 19 near D19Mit23. Relaxin is a peptide hormone produced by the corpora lutea of ovaries during pregnancy in many mammalian species, including man. Relaxin widens the pubic bone and facilitates labor, it also softens the cervix (cervical ripening), and relaxes the uterine musculature. However, its significance may reach much further. Relaxin affects collagen metabolism, inhibiting collagen synthesis and enhancing its breakdown by increasing matrix metalloproteinases. It also enhances angiogenesis and is a potent renal vasodilator.

Synonyms: Prorelaxin H1, Relaxin B chain, Relaxin A chain, RLN1

Gen-ID: 6013

UniProt: P04808