FH Antikörper
-
- Target Alle FH Antikörper anzeigen
- FH (Fumarate Hydratase (FH))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for FH detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- YDKAAKIAKT AHKNGSTLKE TAIELGYLTA EQFDEWVKPK DMLGPK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for FH detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: fumarate hydratase
Protein Name: Fumarate hydratase, mitochondrial - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).
- Isotyp
- IgG
- Top Product
- Discover our top product FH Primärantikörper
-
-
- Applikationshinweise
- Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Kommentare
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- FH (Fumarate Hydratase (FH))
- Andere Bezeichnung
- FH (FH Produkte)
- Synonyme
- FH antikoerper, DDBDRAFT_0205237 antikoerper, DDBDRAFT_0231397 antikoerper, DDBDRAFT_0231400 antikoerper, DDB_0205237 antikoerper, DDB_0231397 antikoerper, DDB_0231400 antikoerper, HLRCC antikoerper, LRCC antikoerper, MCL antikoerper, MCUL1 antikoerper, Fh1 antikoerper, im:7152785 antikoerper, ns:zf-e152 antikoerper, zf-e152 antikoerper, zgc:66253 antikoerper, zgc:77498 antikoerper, Fh antikoerper, Fh-1 antikoerper, fumarate hydratase antikoerper, fumarate hydratase 1 antikoerper, FH antikoerper, fumH antikoerper, Fh antikoerper, fh antikoerper, Fh1 antikoerper
- Hintergrund
-
Fumarase (or fumaratehydratase) is an enzyme that catalyzes the reversible hydration/dehydration of fumarate to malate. Fumarase comes in two forms: mitochondrial and cytosolic. The mitochondrial isoenzyme is involved in the Krebs Cycle (also known as the Tricarboxylic Acid Cycle [TCA] or the Citric Acid Cycle), and the cytosolic isoenzyme is involved in the metabolism of amino acids and fumarate. Subcellular localization is established by the presence of a signal sequence on the amino terminus in the mitochondrial form, while subcellular localization in the cytosolic form is established by the absence of the signal sequence found in the mitochondrial variety. This enzyme participates in 2 metabolic pathways: citric acid cycle, reductive citric acid cycle (CO2 fixation), and is also important in renal cell carcinoma. Mutations in this gene have been associated with the development of leiomyomas in the skin and uterus in combination with renal cell carcinoma.
Synonyms: Fumarate hydratase, mitochondrial, Fumarase, FH, - Gen-ID
- 2271
- UniProt
- P07954
-