SRY Antikörper (Middle Region)
-
- Target Alle SRY Antikörper anzeigen
- SRY (Sex Determining Region Y (SRY))
-
Bindungsspezifität
- AA 90-130, Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SRY Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Sex-determining region Y protein(SRY) detection. Tested with WB in Human.
- Sequenz
- ISKQLGYQWK MLTEAEKWPF FQEAQKLQAM HREKYPNYKY R
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Sex-determining region Y protein(SRY) detection. Tested with WB in Human.
Gene Name: sex determining region Y
Protein Name: Sex-determining region Y protein - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human SRY (90-130aa ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR).
- Isotyp
- IgG
- Top Product
- Discover our top product SRY Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SRY (Sex Determining Region Y (SRY))
- Andere Bezeichnung
- SRY (SRY Produkte)
- Synonyme
- SRXX1 antikoerper, SRXY1 antikoerper, TDF antikoerper, TDY antikoerper, SRYGENE antikoerper, Sry1 antikoerper, Sry3BI antikoerper, Tdf antikoerper, Tdy antikoerper, SRY antikoerper, sex determining region Y antikoerper, sex determining region of Chr Y antikoerper, SRY antikoerper, Sry antikoerper
- Hintergrund
-
This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome), translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.
Synonyms: Sex-determining region Y protein, Testis-determining factor, SRY, TDF - Gen-ID
- 6736
- UniProt
- Q05066
-