ATOH1 Antikörper (N-Term)

Produktnummer ABIN5518893

Produktdetails anti-ATOH1 Antikörper

Target: ATOH1 (Atonal Homolog 1 (Drosophila) (ATOH1))

Bindungsspezifität: AA 1-30, N-Term

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATOH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Protein atonal homolog 1(ATOH1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: MSRLLHAEEW AEVKELGDHH RQPQPHHLPQ

Kreuzreaktivität (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Produktmerkmale: Rabbit IgG polyclonal antibody for Protein atonal homolog 1(ATOH1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: atonal bHLH transcription factor 1
Protein Name: Protein atonal homolog 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MATH1/HATH1 (1-30aa MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ), different from the related mouse sequence by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ATOH1

Target: ATOH1 (Atonal Homolog 1 (Drosophila) (ATOH1))

Andere Bezeichnung: ATOH1 (ATOH1 Produkte)

Synonyme: Atoh1.1 antikoerper, ZATH-1 antikoerper, ath1 antikoerper, atoh1 antikoerper, zath1 antikoerper, zgc:136417 antikoerper, CATH1 antikoerper, Atoh1.2 antikoerper, Tath1 antikoerper, ATOH1 antikoerper, ATH1 antikoerper, HATH1 antikoerper, MATH-1 antikoerper, bHLHa14 antikoerper, Hath1 antikoerper, Math1 antikoerper, RGD1565171 antikoerper, atonal bHLH transcription factor 1a antikoerper, atonal homolog 1 (Drosophila) antikoerper, atonal bHLH transcription factor 1b antikoerper, absent MD neurons and olfactory sensilla antikoerper, atonal bHLH transcription factor 1 antikoerper, atoh1a antikoerper, ATOH1 antikoerper, atoh1b antikoerper, LOC663144 antikoerper, Atoh1 antikoerper

Hintergrund: Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is required for the formation of both neural and non-neural cell types. Using genetic deletion in mice, Atoh1 has been shown to be essential for formation of cerebellar granule neurons, inner ear hair cells, spinal cord interneurons, Merkel cells of the skin, and intestinal secretory cells (goblet, enteroendocrine, and Paneth cells).

Synonyms: Protein atonal homolog 1, Class A basic helix-loop-helix protein 14, bHLHa14, Helix-loop-helix protein hATH-1, hATH1, ATOH1, ATH1, BHLHA14, MATH 1, MATH1

Gen-ID: 474

UniProt: Q92858