OTC Antikörper (N-Term)

Produktnummer ABIN5518860

Produktdetails anti-OTC Antikörper

Target: OTC (Ornithine Carbamoyltransferase (OTC))

Bindungsspezifität: AA 33-70, N-Term

Reaktivität: Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OTC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Ornithine carbamoyltransferase, mitochondrial(OTC) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: NKVQLKGRDL LTLKNFTGEE IKYMLWLSAD LKFRIKQK

Kreuzreaktivität (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Produktmerkmale: Rabbit IgG polyclonal antibody for Ornithine carbamoyltransferase, mitochondrial(OTC) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ornithine carbamoyltransferase
Protein Name: Ornithine carbamoyltransferase, mitochondrial

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human OTC (33-70aa NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK), different from the related mouse and rat sequences by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu OTC

Target: OTC (Ornithine Carbamoyltransferase (OTC))

Andere Bezeichnung: OTC (OTC Produkte)

Synonyme: OCTD antikoerper, 2810428A13Rik antikoerper, AA589422 antikoerper, AW457381 antikoerper, OCT antikoerper, Plxn2 antikoerper, mKIAA0463 antikoerper, F1B16.13 antikoerper, F1B16_13 antikoerper, ORNITHINE CARBAMOYLTRANSFERASE antikoerper, ornithine carbamoyltransferase antikoerper, BA4351 antikoerper, PSPTO4164 antikoerper, PLXN2 antikoerper, AI265390 antikoerper, Sf antikoerper, spf antikoerper, si:dkey-19h21.3 antikoerper, ornithine carbamoyltransferase antikoerper, plexin A2 antikoerper, ornithine carbamoyltransferase ArgF antikoerper, ornithine transcarbamylase antikoerper, OTC antikoerper, Plxna2 antikoerper, Otc antikoerper, argF antikoerper, argF-2 antikoerper, atpD-2 antikoerper, CNC04300 antikoerper, PLXNA2 antikoerper, otc antikoerper

Hintergrund: Ornithine transcarbamylase (OTC) (also called ornithine carbamoyltransferase) is an enzyme that catalyzes the reaction between carbamoyl phosphate (CP) and ornithine (Orn) to form citrulline (Cit) and phosphate (Pi). This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may also play a role in that disease.

Synonyms: OCTD | Otc | OTCase | P00480

Gen-ID: 5009

UniProt: P00480