CYP2D6 Antikörper (C-Term)

Produktnummer ABIN5518823

Produktdetails anti-CYP2D6 Antikörper

Target: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Bindungsspezifität: AA 315-347, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP2D6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Cytochrome P450 2D6(CYP2D6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: AWGLLLMILH PDVQRRVQQE IDDVIGQVRR PEM

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Cytochrome P450 2D6(CYP2D6) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cytochrome P450, family 2, subfamily D, polypeptide 6
Protein Name: Cytochrome P450 2D6

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CYP2D6

Target: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Andere Bezeichnung: CYP2D6 (CYP2D6 Produkte)

Synonyme: CPD6 antikoerper, CYP2D antikoerper, CYP2D7AP antikoerper, CYP2D7BP antikoerper, CYP2D7P2 antikoerper, CYP2D8P2 antikoerper, CYP2DL1 antikoerper, CYPIID6 antikoerper, P450-DB1 antikoerper, P450C2D antikoerper, P450DB1 antikoerper, CYP2D42 antikoerper, MGC64445 antikoerper, cyp2d2 antikoerper, cyp2d6-a antikoerper, CYP2D6 antikoerper, cytochrome P450 family 2 subfamily D member 6 antikoerper, cytochrome P450, family 2, subfamily D, polypeptide 6 antikoerper, cytochrome 2D6 antikoerper, cytochrome P450 family 2 subfamily D member 6 S homeolog antikoerper, cytochrome P450 2D6 antikoerper, cytochrome P450 2D6-like antikoerper, CYP2D6 antikoerper, cyp2d6-b antikoerper, cyp2d6.S antikoerper, cyp2d6 antikoerper, LOC100988273 antikoerper

Hintergrund: Cytochrome P450 2D6 (CYP2D6) is one of the most important enzymes involved in the metabolism of xenobiotics in the body. It is a member of Cytochrome P450, family 2, subfamily D, polypeptide 6. This gene is mapped to chromosome 22q13.1. It has got 497 amino acid proteins which shares 73 % sequence identity with the rat protein. CYP2D6 is highly expressed in human liver and it is the major isozyme involved in the formation of N-hydroxyprocainamide, a metabolite potentially involved in the drug-induced lupus syndrome observed with procainamide.

Synonyms: Cytochrome P450 2D6 | 1.14.14.1 | CYPIID6 | Cytochrome P450-DB1 | Debrisoquine 4-hydroxylase | CYP2D6 | CYP2DL1 | P10635

Gen-ID: 1565

UniProt: P10635