TNFAIP6 Antikörper (N-Term)

Produktnummer ABIN5518793

Produktdetails anti-TNFAIP6 Antikörper

Target: TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))

Bindungsspezifität: AA 46-91, N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TNFAIP6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Tumor necrosis factor-inducible gene 6 protein(TNFAIP6) detection. Tested with WB in Human,Rat.

Sequenz: KYKLTYAEAK AVCEFEGGHL ATYKQLEAAR KIGFHVCAAG WMAKGR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Tumor necrosis factor-inducible gene 6 protein(TNFAIP6) detection. Tested with WB in Human,Rat.
Gene Name: TNF alpha induced protein 6
Protein Name: Tumor necrosis factor-inducible gene 6 protein

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TSG6 (46-91aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR), different from the related mouse sequence by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu TNFAIP6

Target: TNFAIP6 (Tumor Necrosis Factor-Inducible Protein 6 (TNFAIP6))

Andere Bezeichnung: TNFAIP6 (TNFAIP6 Produkte)

Synonyme: Tnfip6 antikoerper, TSG-6 antikoerper, Tsg6 antikoerper, TSG6 antikoerper, TNF alpha induced protein 6 antikoerper, tumor necrosis factor alpha induced protein 6 antikoerper, Tnfaip6 antikoerper, TNFAIP6 antikoerper

Hintergrund: Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.

Synonyms: TNFAIP 6 | Tnfaip6 | TSG 6 | TSG-6 | P98066

Gen-ID: 7130

UniProt: P98066