GAD65 Antikörper (N-Term)

Produktnummer ABIN5518755

Produktdetails anti-GAD65 Antikörper

Target: GAD65 (GAD2) (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kDa) (GAD2))

Bindungsspezifität: AA 131-164, N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAD65 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Glutamate decarboxylase 2(GAD2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KVIDFHYPNE LLQEYNWELA DQPQNLEEIL MHCQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Glutamate decarboxylase 2(GAD2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: glutamate decarboxylase 2 (pancreatic islets and brain, 65 kDa)
Protein Name: Glutamate decarboxylase 2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-GAD65 Antikörper (ABIN5518755)

Tian, Ma, Shi, Lou, Liu, Li: "Acrylamide neurotoxicity on the cerebrum of weaning rats." in: Neural regeneration research, Vol. 10, Issue 6, pp. 938-43, (2015) (PubMed).

Details zu GAD65

Target: GAD65 (GAD2) (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kDa) (GAD2))

Andere Bezeichnung: GAD2 (GAD2 Produkte)

Synonyme: GAD65 antikoerper, gad65 antikoerper, F12P19.12 antikoerper, F12P19_12 antikoerper, GLUTAMATE DECARBOXYLASE 2 antikoerper, glutamate decarboxylase 2 antikoerper, zgc:112198 antikoerper, 6330404F12Rik antikoerper, GAD(65) antikoerper, Gad-2 antikoerper, glutamate decarboxylase 2 antikoerper, glutamate decarboxylase 1 antikoerper, glutamic acid decarboxylase 2 antikoerper, GAD2 antikoerper, PTRG_06148 antikoerper, LOC9324534 antikoerper, Gad2 antikoerper, GAD1 antikoerper, gad2 antikoerper

Hintergrund: Glutamate decarboxylase 2, also known as GAD65, is an enzyme that in humans is encoded by the GAD2 gene. This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.

Synonyms: 4.1.1.15 | 65 kDa glutamic acid decarboxylase | DCE 2 | DCE2 | GAD 2 | GAD 65 | GAD2 | GAD-2 | GAD65 | GAD-65 | Glutamate decarboxylase 2 | Glutamate Decarboxylase 65 | Q05329

Gen-ID: 2572

UniProt: Q05329