Annexin VIII Antikörper (N-Term)

Produktnummer ABIN5518736

Produktdetails anti-Annexin VIII Antikörper

Target: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Bindungsspezifität: AA 20-61, N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Annexin VIII Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Annexin A8(ANXA8) detection. Tested with WB in Human.

Sequenz: HFNPDPDAET LYKAMKGIGT NEQAIIDVLT KRSNTQRQQI AK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Annexin A8(ANXA8) detection. Tested with WB in Human.
Gene Name: annexin A8
Protein Name: Annexin A8

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-Annexin VIII Antikörper (ABIN5518736)

Salenius, Haapanen, Harju, Jokela, Riekkinen: "Late carotid restenosis: aetiologic factors for recurrent carotid artery stenosis during long-term follow-up." in: European journal of vascular surgery, Vol. 3, Issue 3, pp. 271-7, (1989) (PubMed).

Details zu Annexin VIII

Target: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Andere Bezeichnung: ANXA8 (ANXA8 Produkte)

Synonyme: ANX8 antikoerper, ANXA8L1 antikoerper, ANXA8L2 antikoerper, AI466995 antikoerper, Anx8 antikoerper, anx8 antikoerper, MGC85309 antikoerper, ANXA8 antikoerper, annexin A8 antikoerper, annexin A8 S homeolog antikoerper, ANXA8 antikoerper, Anxa8 antikoerper, anxa8.S antikoerper, LOC694628 antikoerper, LOC100052045 antikoerper

Hintergrund: ANXA8 is also known as ANNEXIN VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

Synonyms: Annexin-8 | AnnexinVIII | ANX8 | ANXA8 | P13928 | VAC-beta | Vascular anticoagulant-beta | Annexin VIII

Gen-ID: 653145

UniProt: P13928