ADAM2 Antikörper (N-Term)
-
- Target Alle ADAM2 Antikörper anzeigen
- ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))
-
Bindungsspezifität
- AA 231-274, N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADAM2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 2(ADAM2) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- WIDENKIATT GEANELLHTF LRWKTSYLVL RPHDVAFLLV YREK
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 2(ADAM2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ADAM metallopeptidase domain 2
Protein Name: Disintegrin and metalloproteinase domain-containing protein 2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231-274aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK), different from the related mouse and rat sequences by eleven amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product ADAM2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))
- Andere Bezeichnung
- ADAM2 (ADAM2 Produkte)
- Synonyme
- AI323749 antikoerper, Ftnb antikoerper, Ph30-beta antikoerper, CRYN1 antikoerper, CRYN2 antikoerper, CT15 antikoerper, FTNB antikoerper, PH-30b antikoerper, PH30 antikoerper, PH30-beta antikoerper, PH-30 antikoerper, a disintegrin and metallopeptidase domain 2 antikoerper, ADAM metallopeptidase domain 2 antikoerper, Adam2 antikoerper, ADAM2 antikoerper
- Hintergrund
-
ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2.
Synonyms: ADAM2 | CT15 | Fertilin beta | Fertilin subunit beta | Ftnb | PH30 | PH-30 | Ph30 beta | PH30-beta | Q99965 - Gen-ID
- 2515
- UniProt
- Q99965
-