ABCG8 Antikörper (Middle Region)

Produktnummer ABIN5518720

Produktdetails anti-ABCG8 Antikörper

Target: ABCG8 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 8 (ABCG8))

Bindungsspezifität: AA 328-371, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ABCG8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family G member 8(ABCG8) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: DRRSREQELA TREKAQSLAA LFLEKVRDLD DFLWKAETKD LDED

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family G member 8(ABCG8) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ATP binding cassette subfamily G member 8
Protein Name: ATP-binding cassette sub-family G member 8

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ABCG8 (328-371aa DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED), different from the related mouse and rat sequences by twelve amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ABCG8

Target: ABCG8 (ATP-Binding Cassette, Sub-Family G (WHITE), Member 8 (ABCG8))

Andere Bezeichnung: ABCG8 (ABCG8 Produkte)

Synonyme: DDBDRAFT_0167690 antikoerper, DDBDRAFT_0191232 antikoerper, DDB_0167690 antikoerper, DDB_0191232 antikoerper, zgc:172358 antikoerper, GBD4 antikoerper, STSL antikoerper, 1300003C16Rik antikoerper, AI114946 antikoerper, sterolin-2 antikoerper, ATP binding cassette subfamily G member 8 antikoerper, ATP-binding cassette sub-family G member 8 antikoerper, ABC transporter G family protein antikoerper, ATP-binding cassette, sub-family G (WHITE), member 8 antikoerper, ABCG8 antikoerper, PTRG_02054 antikoerper, abcG8 antikoerper, abcg8 antikoerper, Abcg8 antikoerper

Hintergrund: ATP-binding cassette sub-family G member 8 is a protein that in humans is encoded by the ABCG8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions to exclude non-cholesterol sterol entry at the intestinal level, promote excretion of cholesterol and sterols into bile, and to facilitate transport of sterols back into the intestinal lumen. It is expressed in a tissue-specific manner in the liver, intestine, and gallbladder. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG5. Mutations in this gene may contribute to sterol accumulation and atherosclerosis, and have been observed in patients with sitosterolemia.

Synonyms: ABCG8 | GBD4 | Sterolin 2 | Sterolin-2 | TSL | Q9H221

Gen-ID: 64241

UniProt: Q9H221

Pathways: Lipid Metabolism