ABCA4 Antikörper (C-Term)
-
- Target Alle ABCA4 Antikörper anzeigen
- ABCA4 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 4 (ABCA4))
-
Bindungsspezifität
- AA 1890-1927, C-Term
-
Reaktivität
- Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABCA4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Retinal-specific ATP-binding cassette transporter(ABCA4) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- FLLTLLVQRH FFLSQWIAEP TKEPIVDEDD DVAEERQR
- Kreuzreaktivität (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Produktmerkmale
-
Rabbit IgG polyclonal antibody for Retinal-specific ATP-binding cassette transporter(ABCA4) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: ATP-binding cassette, sub-family A (ABC1), member 4
Protein Name: Retinal-specific ATP-binding cassette transporter - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA4 (1890-1927aa FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR), different from the related mouse sequence by eight amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product ABCA4 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ABCA4 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 4 (ABCA4))
- Andere Bezeichnung
- ABCA4 (ABCA4 Produkte)
- Synonyme
- ABC10 antikoerper, ABCR antikoerper, ARMD2 antikoerper, CORD3 antikoerper, FFM antikoerper, RMP antikoerper, RP19 antikoerper, STGD antikoerper, STGD1 antikoerper, AW050280 antikoerper, Abc10 antikoerper, Abcr antikoerper, D430003I15Rik antikoerper, RmP antikoerper, abcr antikoerper, ffm antikoerper, rmp antikoerper, rp19 antikoerper, stgd antikoerper, abc10 antikoerper, armd2 antikoerper, cord3 antikoerper, stgd1 antikoerper, zgc:91823 antikoerper, ATP binding cassette subfamily A member 4 antikoerper, ATP-binding cassette, sub-family A (ABC1), member 4 antikoerper, ATP binding cassette subfamily A member 4 L homeolog antikoerper, ATP-binding cassette, sub-family A (ABC1), member 4a antikoerper, ABCA4 antikoerper, Abca4 antikoerper, abca4 antikoerper, abca4.L antikoerper, abca4a antikoerper
- Hintergrund
-
ABCA4 (ATP-Binding Cassette, Subfamily A, Member 4), also known as ABCR, is a protein which in humans is encoded by the ABCA4 gene. ABCA4 is a member of the ATP-binding cassette transporter gene sub-family A (ABC1) found exclusively in multicellular eukaryotes. Using a whole genome radiation hybrid panel, this gene is mapped to 1p21-p13. And this gene is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Additionally, it is showed by immunofluorescence microscopy and Western blot analysis that ABCR is present in foveal and peripheral cone, as well as rod, photoreceptors. The results suggested that the loss in central vision experienced by patients with Stargardt macular dystrophy arises directly from ABCR-mediated foveal cone degeneration.
Synonyms: ABCA 4 | ABCA4 | ABCR | ARMD 2 | ARMD2 | ATP binding cassette 10 | CORD3 | FFM | P78363 | Photoreceptor rim protein | RIM ABC transporter | RIM protein | RmP | RP19 | Stargardt disease protein | STGD | STGD1 - Gen-ID
- 24
- UniProt
- P78363
-