FZD10 Antikörper

Produktnummer ABIN5516677

Produktdetails anti-FZD10 Antikörper

Target: FZD10 (Frizzled Family Receptor 10 (FZD10))

Reaktivität: Human, Maus, Schwein, Rind (Kuh), Hund, Pferd

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FZD10 Antikörper ist unkonjugiert

Applikation: Immunofluorescence (IF)

Sequenz: GMWIWTSKTL QSWQQVCSRR LKKKSRRKPA SVITSGGIYK KAQHPQKTHH

Homologie: Cow: 92%, Dog: 92%, Horse: 92%, Human: 100%, Mouse: 92%, Pig: 100%

Aufreinigung: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH

Anwendungsinformationen

Applikationshinweise: Optimal working dilution should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: -20 °C

Informationen zur Lagerung: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Details zu FZD10

Target: FZD10 (Frizzled Family Receptor 10 (FZD10))

Andere Bezeichnung: FZD10 (FZD10 Produkte)

Synonyme: CD350 antikoerper, FZ-10 antikoerper, Fz10 antikoerper, FzE7 antikoerper, hFz10 antikoerper, cFz-10 antikoerper, Fz-10 antikoerper, Xfr9 antikoerper, Xfz10 antikoerper, frizzled-10 antikoerper, frizzled10 antikoerper, fz10 antikoerper, fze7 antikoerper, hfz10 antikoerper, fk48e04 antikoerper, fz4 antikoerper, fzb antikoerper, wu:fk48e04 antikoerper, zg04 antikoerper, Xfz10A antikoerper, fzd10a antikoerper, Xfz10B antikoerper, Xfz9 antikoerper, fzd10b antikoerper, fzd9 antikoerper, frizzled class receptor 10 antikoerper, frizzled class receptor 10 L homeolog antikoerper, frizzled class receptor 10 S homeolog antikoerper, FZD10 antikoerper, fzd10 antikoerper, Fzd10 antikoerper, fzd10.L antikoerper, fzd10.S antikoerper

Hintergrund: This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.

Alias Symbols: Fz10, FzE7, CD350, FZ-10, hFz10,

Protein Size: 581

Gen-ID: 11211

NCBI Accession: NM_007197, NP_009128

UniProt: Q9ULW2

Pathways: WNT Signalweg