SPEN Antikörper (Spen Homolog, Transcriptional Regulator (Drosophila))

Details for Product anti-SPEN Antibody No. ABIN5079831, Anbieter: Anmelden zum Anzeigen
Antigen
  • OTT
  • OTT1
  • SPEN
  • HIAA0929
  • MINT
  • RBM15C
  • SHARP
  • Mint
  • mKIAA0929
  • spen homolog, transcriptional regulator (Drosophila)
  • RNA binding motif protein 15
  • SPEN homolog, transcriptional regulator (Drosophila)
  • SPEN
  • RBM15
  • Spen
Reaktivität
Human
19
2
2
1
1
1
1
Wirt
Kaninchen
14
6
Klonalität
Polyklonal
Konjugat
Dieser SPEN Antikörper ist unkonjugiert
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
13
5
2
2
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GEAVENQEVQSKKPIPSKPQLKQLQVLDDQGPEREDVRKNYCSLRDETPERKSGQEKSHSVNTEEKIGIDIDHTQSYRKQMEQSRRKQQMEMEIAKSEKFGSPKKDVDEYERRSLVHEVGKPPQDVTDDSPPSK
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Andere Bezeichnung SPEN (SPEN Antibody Abstract)
Hintergrund Gene Symbol: SPEN
Gen-ID 23013
Forschungsgebiet Chromatin Binding Proteins, Transcription Factors, Chromatin and Nuclear Signaling
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunofluorescence (IF) image for anti-SPEN Antikörper (Spen Homolog, Transcriptional Regulator (Drosophila)) (ABIN5079831) Immunocytochemistry/Immunofluorescence: SPEN Antibody - Staining of human cell line ...