Ephrin A5 Antikörper (EFNA5)

Details for Product anti-EFNA5 Antibody No. ABIN5076560, Anbieter: Anmelden zum Anzeigen
Antigen
  • EFNA5
  • af1
  • efl5
  • rags
  • eplg7
  • lerk7
  • AL-1
  • AV158822
  • EFL-5
  • Ephrin-A5
  • Epl7
  • LERK-7
  • RAGS
  • Lerk7
  • AF1
  • EFL5
  • EPLG7
  • GLC1M
  • LERK7
  • ephrin-A5-like
  • ephrin-A5
  • ephrin A5
  • LOC100073202
  • EFNA5
  • efna5
  • LOC100228846
  • Efna5
  • LOC100358004
  • LOC100513721
Reaktivität
Human
62
48
43
9
8
6
5
5
4
3
2
2
2
1
1
Wirt
Kaninchen
57
9
5
1
Klonalität
Polyklonal
Konjugat
Dieser Ephrin A5 Antikörper ist unkonjugiert
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF)
49
35
17
15
14
13
4
3
3
3
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Affinity purified
Andere Bezeichnung Ephrin-A5 (EFNA5 Antibody Abstract)
Hintergrund Gene Symbol: EFNA5
Gen-ID 1946
Pathways RTK Signalweg
Applikationshinweise Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Ephrin A5 (EFNA5) antibody (ABIN5076560) Immunocytochemistry/Immunofluorescence: Ephrin-A5 Antibody - Staining of human cell ...
Produkt verwendet in: Andretta, Cartón-García, Martínez-Barriocanal, de Marcondes, Jimenez-Flores, Macaya, Bazzocco, Bilic, Rodrigues, Nieto, Landolfi, Ramon Y Cajal, Schwartz, Brown, Dopeso, Arango: "Investigation of the role of tyrosine kinase receptor EPHA3 in colorectal cancer." in: Scientific reports, Vol. 7, pp. 41576, 2017 (PubMed). Von den Autoren verwendete Methode: Western Blotting (WB) (Probematerial (Species): Mouse (Murine)).

Haben Sie etwas anderes gesucht?