c-Rel Antikörper

Produktnummer ABIN4950367

Produktdetails anti-c-Rel Antikörper

Target: c-Rel (REL proto-oncogene (c-Rel))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser c-Rel Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: Amino acids DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD of mouse c-Rel were used as the immunogen for the c-Rel antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the c-Rel antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the c-Rel antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu c-Rel

Target: c-Rel (REL proto-oncogene (c-Rel))

Andere Bezeichnung: c-Rel / REL (c-Rel Produkte)

Synonyme: C-Rel antikoerper, c-Rel antikoerper, NFkB antikoerper, c-rel antikoerper, zgc:100833 antikoerper, Xrel2 antikoerper, Xrel3 antikoerper, rel antikoerper, rel-A antikoerper, rel2 antikoerper, rel3 antikoerper, v-rel antikoerper, xrel antikoerper, REL proto-oncogene, NF-kB subunit antikoerper, reticuloendotheliosis oncogene antikoerper, RELA proto-oncogene, NF-kB subunit antikoerper, v-rel avian reticuloendotheliosis viral oncogene homolog antikoerper, v-rel avian reticuloendotheliosis viral oncogene homolog L homeolog antikoerper, ribonuclease A family member 2 pseudogene antikoerper, REL antikoerper, Rel antikoerper, Rela antikoerper, rel antikoerper, rel.L antikoerper, ECRP antikoerper

Hintergrund: The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome 2p13-p12. The c-Rel protein is a member of the NF-kB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains. c-Rel has an important role in B-cell survival and proliferation. The REL gene is amplified or mutated in several human B-cell lymphomas, including diffuse large B-cell lymphoma and Hodgkin's lymphoma.

UniProt: P15307