DnaJ (Hsp40) Homolog, Subfamily C, Member 19 (DNAJC19) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4895104, Anbieter: Anmelden zum Anzeigen
Antigen
  • zgc:73251
  • DNAJC19
  • TIM14
  • TIMM14
  • DKFZp469M2132
  • PAM18
  • 1810055D05Rik
  • AA959924
  • Tim14
  • DnaJ (Hsp40) homolog, subfamily C, member 19
  • DnaJ homolog, subfamily C, member 19
  • similar to S. cerevisiae PAM18 (YLR008C) DnaJ-like mitochondrial import motor component
  • dnajc19
  • DNAJC19
  • LOC100348759
  • Dnajc19
  • PAM18
Epitop
N-Term
5
4
3
3
2
2
2
2
2
1
1
1
1
Reaktivität
Maus
30
16
8
4
3
3
3
2
2
2
1
1
1
Wirt
Kaninchen
23
8
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
29
10
2
1
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen The immunogen for this antibody is Dnajc19 - N-terminal region. Peptide sequence QVFQSLPKSAFGGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRR.
Reinigung Immunogen affinity purified
Andere Bezeichnung DNAJC19 (DNAJC19 Antibody Abstract)
Hintergrund Gene Symbol: DNAJC19
Molekulargewicht Theoretical MW: 116 kDa
Gen-ID 131118
NCBI Accession NP_080608
Forschungsgebiet Neurology, Heat Shock Proteins
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-DnaJ (Hsp40) Homolog, Subfamily C, Member 19 (DNAJC19) (N-Term) antibody (ABIN4895104) Western Blot: DNAJC19 Antibody [NBP1-98468] - Mouse Brain Lysate 1.0ug/ml, Gel Concen...
Haben Sie etwas anderes gesucht?