Voltage-Dependent Anion Channel 3 (VDAC3) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4894330, Anbieter: Anmelden zum Anzeigen
  • HD-VDAC3
  • VDAC-3
  • VDAC1P5
  • VDAC5P
  • VDAC3
  • wu:fb01e12
  • zgc:77898
  • hd-vdac3
  • voltage dependent anion channel 3
  • voltage-dependent anion channel 3
  • voltage-dependent anion channel 3 L homeolog
  • VDAC3
  • Vdac3
  • vdac3
  • vdac3.L
Immunohistochemistry (IHC), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the N terminal of human VDAC3. Peptide sequence: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF
Reinigung Immunogen affinity purified
Andere Bezeichnung VDAC3 (VDAC3 Antibody Abstract)
Hintergrund Gene Symbol: VDAC3
Gen-ID 7419
NCBI Accession NP_005653
Forschungsgebiet Signaling, Metabolism, Apoptosis/Necrosis
Applikationshinweise Western Blot 1:1000, ImmunohistochemistryThis is a rabbit polyclonal antibody against VDAC3 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Voltage-Dependent Anion Channel 3 (VDAC3) (N-Term) antibody (ABIN4894330) Western Blot: VDAC3 Antibody [NBP1-80070] - Analysis of 721_B cell lysate. Antibody D...
Western Blotting (WB) image for anti-Voltage-Dependent Anion Channel 3 (VDAC3) (N-Term) antibody (ABIN4894330) Western Blot: VDAC3 Antibody [NBP1-80070] - Human Fetal Muscle, Antibody Dilution: 1....
Western Blotting (WB) image for anti-Voltage-Dependent Anion Channel 3 (VDAC3) (N-Term) antibody (ABIN4894330) Western Blot: VDAC3 Antibody [NBP1-80070] - Human Heart lysate, concentration 0.2-1 u...
Western Blotting (WB) image for anti-Voltage-Dependent Anion Channel 3 (VDAC3) (N-Term) antibody (ABIN4894330) Western Blot: VDAC3 Antibody [NBP1-80070] - Human Fetal Heart, Antibody Dilution: 1.0...
Immunohistochemistry (IHC) image for anti-Voltage-Dependent Anion Channel 3 (VDAC3) (N-Term) antibody (ABIN4894330) Immunohistochemistry: VDAC3 Antibody [NBP1-80070] - Human Lung cell Cellular data: Ep...
Haben Sie etwas anderes gesucht?