DnaJ (Hsp40) Homolog, Subfamily C, Member 19 (DNAJC19) (C-Term), (Isoform TIM14) Antikörper

Details zu Produkt Nr. ABIN4892911, Anbieter: Anmelden zum Anzeigen
  • zgc:73251
  • DNAJC19
  • TIM14
  • TIMM14
  • DKFZp469M2132
  • PAM18
  • 1810055D05Rik
  • AA959924
  • Tim14
  • DnaJ (Hsp40) homolog, subfamily C, member 19
  • DnaJ heat shock protein family (Hsp40) member C19
  • DnaJ heat shock protein family (Hsp40) member C19 L homeolog
  • Pam18p
  • dnajc19
  • DNAJC19
  • dnajc19.L
  • Dnajc19
  • PAM18
C-Term, Isoform TIM14
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to DNAJC19 (DnaJ (Hsp40) homolog, subfamily C, member 19) The peptide sequence was selected from the C terminal of DNAJC19. Peptide sequence LGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK.
Spezifität This product is specific to Subunit or Isoform: TIM14.
Reinigung Immunogen affinity purified
Andere Bezeichnung DNAJC19 (DNAJC19 Antibody Abstract)
Hintergrund Gene Symbol: DNAJC19
Molekulargewicht Theoretical MW: 13 kDa
Gen-ID 131118
UniProt Q96DA6
Forschungsgebiet Neurology, Heat Shock Proteins
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against DNAJC19 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-DnaJ (Hsp40) Homolog, Subfamily C, Member 19 (DNAJC19) (C-Term), (Isoform TIM14) antibody (ABIN4892911) Western Blot: DNAJC19 Antibody [NBP1-68991] - Human Placenta lysate, concentration 0....
Haben Sie etwas anderes gesucht?