Protocadherin alpha 6 (PCDHA6) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4892187, Anbieter: Anmelden zum Anzeigen
Antigen
  • CNR2
  • CNRN2
  • CNRS2
  • CRNR2
  • PCDH-ALPHA6
  • CNR
  • Cnr2
  • Crnr2
  • rCNRv06
  • PCDHA3
  • PCDHA6
  • PCDHA7
  • PCDHA9
  • protocadherin alpha 6
  • PCDHA6
  • Pcdha6
Epitop
C-Term
14
11
9
5
3
3
2
2
1
1
1
1
1
Reaktivität
Human
63
23
22
3
3
2
2
1
1
1
Wirt
Kaninchen
47
16
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
4
4
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
48
29
14
14
13
4
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to PCDHA6(protocadherin alpha 6) The peptide sequence was selected from the C terminal of PCDHA6. Peptide sequence LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY.
Reinigung Immunogen affinity purified
Andere Bezeichnung PCDHA6 (PCDHA6 Antibody Abstract)
Hintergrund Gene Symbol: PCDHA6
Gen-ID 56142
Forschungsgebiet Signaling
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against PCDHA6 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Protocadherin alpha 6 (PCDHA6) (C-Term) antibody (ABIN4892187) Western Blot: PCDHA6 Antibody [NBP1-59262] - 293T cells lysate, concentration 0.2-1 u...
Haben Sie etwas anderes gesucht?