Malignant T Cell Amplified Sequence 1 (MCTS1) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4891880, Anbieter: Anmelden zum Anzeigen
  • MCT-1
  • MCT1
  • 1500019M23Rik
  • zgc:56242
  • mcts1
  • MGC89874
  • MCTS1
  • MCT-1A
  • mct-1
  • mct1
  • MCTS1, re-initiation and release factor
  • malignant T cell amplified sequence 1
  • malignant T-cell amplified sequence 1
  • malignant T-cell amplified sequence 1 S homeolog
  • monocarboxylate transporter 1
  • MCTS1
  • Mcts1
  • mcts1
  • mcts1.S
  • MCT1
Human, Maus
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to MCTS1(malignant T cell amplified sequence 1) The peptide sequence was selected from the N terminal of MCTS1. Peptide sequence MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPV.
Reinigung Immunogen affinity purified
Andere Bezeichnung MCTS1 (MCTS1 Antibody Abstract)
Hintergrund Gene Symbol: MCTS1
Molekulargewicht Theoretical MW: 20 kDa
Gen-ID 28985
UniProt Q9ULC4
Forschungsgebiet Transporters
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against MCTS1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Malignant T Cell Amplified Sequence 1 (MCTS1) (N-Term) antibody (ABIN4891880) Western Blot: MCTS1 Antibody [NBP1-58236] - COLO205 cells lysate, concentration 0.2-1...
Produkt verwendet in: Haas, Ngo, Li, Schleich, Qu, Vanyai, Cullen, Cardona-Alberich, Gladwyn-Ng, Pagnamenta, Taylor, Stewart, Kini, Duncan, Teleman, Keays, Heng: "De Novo Mutations in DENR Disrupt Neuronal Development and Link Congenital Neurological Disorders to Faulty mRNA Translation Re-initiation." in: Cell reports, Vol. 15, Issue 10, pp. 2251-65, 2016 (PubMed). (Probematerial (Species): Mouse (Murine)). Weitere Details: Western Blotting

Haben Sie etwas anderes gesucht?