GNA12 Antikörper (Guanine Nucleotide Binding Protein (G Protein) alpha 12) (Isoform alpha-12)

Details for Product anti-GNA12 Antibody No. ABIN4890651, Anbieter: Anmelden zum Anzeigen
  • NNX3
  • RMP
  • gep
  • gna12
  • gna12l
  • AI414047
  • AI504261
  • Galpha12
  • guanine nucleotide binding protein (G protein) alpha 12
  • guanine nucleotide binding protein (G protein) alpha 12a
  • guanine nucleotide binding protein, alpha 12
  • GNA12
  • Gna12
  • gna12a
Isoform alpha-12
Dieser GNA12 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren


Immunogen Synthetic peptides corresponding to GNA12(guanine nucleotide binding protein (G protein) alpha 12) The peptide sequence was selected from the middle region of GNA12. Peptide sequence TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF.
Spezifität This product is specific to Subunit or Isoform: alpha-12.
Reinigung Immunogen affinity purified
Andere Bezeichnung G Protein alpha 12 (GNA12 Antibody Abstract)
Hintergrund Gene Symbol: GNA12
Molekulargewicht Theoretical MW: 44 kDa
Gen-ID 2768
UniProt Q03113
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against GNA12 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-GNA12 Antikörper (Guanine Nucleotide Binding Protein (G Protein) alpha 12) (Isoform alpha-12) (ABIN4890651) Western Blot: G protein alpha 12 Antibody [NBP1-55321] - Titration: 0.2-1 ug/ml, Posi...