APEH Antikörper (N-Acylaminoacyl-Peptide Hydrolase) (N-Term)

Details for Product anti-APEH Antibody No. ABIN4890432, Anbieter: Anmelden zum Anzeigen
Antigen
  • AARE
  • ACPH
  • APH
  • D3F15S2
  • D3S48E
  • DNF15S2
  • OPH
  • AAP
  • cb5
  • sb:cb5
  • wu:fi37d02
  • acylaminoacyl-peptide hydrolase
  • acylpeptide hydrolase
  • APEH
  • Apeh
  • apeh
Epitop
N-Term
6
4
2
2
2
1
1
Reaktivität
Human
53
31
31
4
4
3
3
3
2
2
1
1
1
Wirt
Kaninchen
53
Klonalität
Polyklonal
Konjugat
Dieser APEH Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
38
19
13
12
11
8
3
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the N terminal of human APEH (NP_001631). Peptide sequence VYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR.
Reinigung Immunogen affinity purified
Andere Bezeichnung APEH (APEH Antibody Abstract)
Hintergrund Gene Symbol: APEH
Molekulargewicht Theoretical MW: 81 kDa
Gen-ID 327
UniProt P13798
Applikationshinweise Western Blot 0.2-1 μg/mL, ImmunohistochemistryThis is a rabbit polyclonal antibody against APEH and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-N-Acylaminoacyl-Peptide Hydrolase (APEH) (N-Term) antibody (ABIN4890432) Western Blot: APEH Antibody [NBP1-54954] - Titration: 0.2-1 ug/ml, Positive Control: ...
Western Blotting (WB) image for anti-N-Acylaminoacyl-Peptide Hydrolase (APEH) (N-Term) antibody (ABIN4890432) Western Blot: APEH Antibody [NBP1-54954] - Antibody Titration: 1 ug/ml Human liver.
Immunohistochemistry (IHC) image for anti-N-Acylaminoacyl-Peptide Hydrolase (APEH) (N-Term) antibody (ABIN4890432) Immunohistochemistry: APEH Antibody [NBP1-54954] - Human Adult liver Observed Stainin...
Haben Sie etwas anderes gesucht?