SLC18A3 Antikörper (N-Term)

Produktnummer ABIN4886722

Produktdetails anti-SLC18A3 Antikörper

Target: SLC18A3 (Solute Carrier Family 18 (Vesicular Acetylcholine), Member 3 (SLC18A3))

Bindungsspezifität: AA 1-36, N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC18A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Vesicular acetylcholine transporter(SLC18A3) detection. Tested with WB in Human,Mouse.

Sequenz: MESAEPAGQA RAAATKLSEA VGAALQEPRR QRRLVL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Vesicular acetylcholine transporter(SLC18A3) detection. Tested with WB in Human,Mouse.
Gene Name: solute carrier family 18 member A3
Protein Name: Vesicular acetylcholine transporter

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC18A3 (1-36aa MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVL), different from the related mouse and rat sequences by five amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu SLC18A3

Target: SLC18A3 (Solute Carrier Family 18 (Vesicular Acetylcholine), Member 3 (SLC18A3))

Andere Bezeichnung: SLC18A3 (SLC18A3 Produkte)

Synonyme: VACht antikoerper, rVAT antikoerper, Slc18a3 antikoerper, MGC64220 antikoerper, VACHT antikoerper, VAChT antikoerper, VAT antikoerper, SLC18A3 antikoerper, CG12345 antikoerper, CG32848 antikoerper, CT41182 antikoerper, Dmel\\CG32848 antikoerper, Vacht antikoerper, vAChT antikoerper, vacht antikoerper, VAChT-A antikoerper, zgc:153442 antikoerper, solute carrier family 18 member A3 antikoerper, solute carrier family 18 (vesicular acetylcholine transporter), member 3b antikoerper, solute carrier family 18 (vesicular monoamine), member 3 antikoerper, solute carrier family 18 (vesicular acetylcholine transporter), member 3 antikoerper, Vesicular acetylcholine transporter antikoerper, solute carrier family 18 (vesicular acetylcholine transporter), member 3a antikoerper, Slc18a3 antikoerper, slc18a3b antikoerper, SLC18A3 antikoerper, slc18a3 antikoerper, VAChT antikoerper, slc18a3a antikoerper

Hintergrund: The Vesicular acetylcholine transporter (VAChT), also known as SLC18A3, is a neurotransmitter transporter which is responsible for loadingacetylcholine (ACh) into secretory organelles in neurons making acetylcholine available for secretion. It is encoded by Solute carrier family 18, member 3 (SLC18A3) gene. This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline acetyltransferase gene.

Synonyms: AChR | Rvat | Slc18a3 | VAChT | Q16572

Gen-ID: 6572

UniProt: Q16572