NFIA Antikörper (Middle Region)

Produktnummer ABIN4886680

Produktdetails anti-NFIA Antikörper

Target: NFIA (Nuclear Factor I/A (NFIA))

Bindungsspezifität: AA 180-224, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NFIA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Nuclear factor 1 A-type(NFIA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: AYFVHAADSS QSESPSQPSD ADIKDQPENG HLGFQDSFVT SG

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Nuclear factor 1 A-type(NFIA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: nuclear factor I A
Protein Name: Nuclear factor 1 A-type

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSG VFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu NFIA

Target: NFIA (Nuclear Factor I/A (NFIA))

Andere Bezeichnung: NFIA (NFIA Produkte)

Synonyme: NFIA antikoerper, CTF antikoerper, NF-I/A antikoerper, NF1-A antikoerper, NFI-A antikoerper, NFI-L antikoerper, si:ch211-88d2.2 antikoerper, wu:fq27e07 antikoerper, zgc:158351 antikoerper, CNFI-A antikoerper, cNFI-A3 antikoerper, 1110047K16Rik antikoerper, 9430022M17Rik antikoerper, NF1A antikoerper, nuclear factor I A antikoerper, nuclear factor I/A antikoerper, NFIA antikoerper, nfia antikoerper, Nfia antikoerper

Hintergrund: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.

Synonyms: CTF | NF I/A | NF-I/A | NF1-A | NFI A | NFI L | NFI-A | NFIA | Q12857

Gen-ID: 4774

UniProt: Q12857