MPP1 Antikörper (C-Term)

Produktnummer ABIN4886673

Produktdetails anti-MPP1 Antikörper

Target: MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))

Bindungsspezifität: AA 409-450, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MPP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for 55 kDa erythrocyte membrane protein(MPP1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: TEALQQLQKD SEAIRSQYAH YFDLSLVNNG VDETLKKLQE AF

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for 55 kDa erythrocyte membrane protein(MPP1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: membrane palmitoylated protein 1
Protein Name: 55 kDa erythrocyte membrane protein

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MPP1 (409-450aa TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF), different from the related mouse sequence by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu MPP1

Target: MPP1 (Membrane Protein, Palmitoylated 1, 55kDa (MPP1))

Andere Bezeichnung: MPP1 (MPP1 Produkte)

Synonyme: AAG12 antikoerper, DXS552E antikoerper, EMP55 antikoerper, MRG1 antikoerper, PEMP antikoerper, MGC53500 antikoerper, MGC89895 antikoerper, MPP1 antikoerper, p55 antikoerper, cb997 antikoerper, zgc:77039 antikoerper, wu:fc85f03 antikoerper, 55kDa antikoerper, C130070C03Rik antikoerper, membrane palmitoylated protein 1 antikoerper, membrane protein, palmitoylated 1 L homeolog antikoerper, membrane protein, palmitoylated 1 antikoerper, membrane protein, palmitoylated antikoerper, MPP1 antikoerper, mpp1.L antikoerper, mpp1 antikoerper, Mpp1 antikoerper

Hintergrund: 55 kDa erythrocyte membrane protein is a protein that in humans is encoded by the MPP1 gene. This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.

Synonyms: AAG 12 | AAG12 | DXS552 | DXS552E | EMP 55 | EMP55 | MPP 1 | MPP1 | MRG 1 | MRG1 | p55 | palmitoylated 1 | PEMP | Q00013

Gen-ID: 4354

UniProt: Q00013