EpCAM Antikörper (Middle Region)

Produktnummer ABIN4886570

Produktdetails anti-EpCAM Antikörper

Target: EpCAM (EPCAM) (Epithelial Cell Adhesion Molecule (EPCAM))

Bindungsspezifität: AA 147-189, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EpCAM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Epithelial cell adhesion molecule(EPCAM) detection. Tested with WB, IHC-P, ELISA, FCM in Human.

Sequenz: ELKHKAREKP YDSKSLRTAL QKEITTRYQL DPKFITSILY ENN

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Epithelial cell adhesion molecule(EPCAM) detection. Tested with WB, IHC-P, ELISA, FCM in Human.
Gene Name: epithelial cell adhesion molecule
Protein Name: Epithelial cell adhesion molecule

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Flow Cytometry: Concentration:1-3 μg/1x106 cells, Tested Species: Human
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-EpCAM Antikörper (ABIN4886570)

Huang, Li, Pan, Cheng, Ren, Jia, Ma, Xu: "A novel multi-target RNAi adenovirus inhibits hepatoma cell proliferation, migration, and induction of angiogenesis." in: Oncotarget, Vol. 7, Issue 36, pp. 57705-57713, (2018) (PubMed).

Zhang, Bu, Sun, Xu, Yao, He, Lai: "Paracrine effects of human amniotic epithelial cells protect against chemotherapy-induced ovarian damage." in: Stem cell research & therapy, Vol. 8, Issue 1, pp. 270, (2018) (PubMed).

Details zu EpCAM

Target: EpCAM (EPCAM) (Epithelial Cell Adhesion Molecule (EPCAM))

Andere Bezeichnung: EPCAM (EPCAM Produkte)

Synonyme: DIAR5 antikoerper, EGP-2 antikoerper, EGP314 antikoerper, EGP40 antikoerper, ESA antikoerper, HNPCC8 antikoerper, KS1/4 antikoerper, KSA antikoerper, M4S1 antikoerper, MIC18 antikoerper, MK-1 antikoerper, TACSTD1 antikoerper, TROP1 antikoerper, ECS-1 antikoerper, ECS1 antikoerper, ESA1 antikoerper, M17S1 antikoerper, EGP antikoerper, Ep-CAM antikoerper, sb:cb6 antikoerper, tacstd antikoerper, wu:fj17g02 antikoerper, zgc:110304 antikoerper, zgc:77119 antikoerper, tacstd1 antikoerper, MGC80540 antikoerper, EPCAM antikoerper, egp antikoerper, ksa antikoerper, m4s1 antikoerper, mk-1 antikoerper, cd326 antikoerper, egp40 antikoerper, mic18 antikoerper, trop1 antikoerper, ep-cam antikoerper, hegp-2 antikoerper, co17-1a antikoerper, ga733-2 antikoerper, CD326 antikoerper, Egp314 antikoerper, EpCAM1 antikoerper, GA733-2 antikoerper, Ly74 antikoerper, Tacsd1 antikoerper, Tacstd1 antikoerper, gp40 antikoerper, epithelial cell adhesion molecule antikoerper, flotillin 2 antikoerper, epithelial cell adhesion molecule S homeolog antikoerper, EPCAM antikoerper, FLOT2 antikoerper, epcam antikoerper, epcam.S antikoerper, Epcam antikoerper

Hintergrund: Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell-cell adhesion in epithelia. This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.

Synonyms: AUA1 | CD326 | CD326 antigen | CO 17A | CO17 1A | CO17A | DIAR5 | EGP 2 | EGP | EGP2 | EGP314 | EGP40 | Ep CAM | EpCAM |Ep-CAM | Epithelial glycoprotein | ESA | GA733 1 | GA733 2 | GA733-2 | KS1/4 | M1S 1 | M1S2 | M4S1 | MIC18 | MK 1 | TACD1 | TACSTD1 | TROP1 | P16422

Gen-ID: 4072

UniProt: P16422