Emerin Antikörper (N-Term)

Produktnummer ABIN4886569

Produktdetails anti-Emerin Antikörper

Target: Emerin (EMD)

Bindungsspezifität: AA 1-48, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Emerin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Emerin(EMD) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: MDNYADLSDT ELTTLLRRYN IPHGPVVGST RRLYEKKIFE YETQRRRL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Emerin(EMD) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: emerin
Protein Name: Emerin

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Emerin

Target: Emerin (EMD)

Andere Bezeichnung: EMD (EMD Produkte)

Synonyme: fj58f01 antikoerper, wu:fj58f01 antikoerper, EMD antikoerper, Bocks antikoerper, Bocksbeutel antikoerper, CG9424 antikoerper, Dmel\\CG9424 antikoerper, emerin antikoerper, emd antikoerper, xemd1 antikoerper, xemerin2 antikoerper, xemd2 antikoerper, xemerin1 antikoerper, EDMD antikoerper, LEMD5 antikoerper, STA antikoerper, AW550900 antikoerper, Sta antikoerper, emerin antikoerper, emerin (Emery-Dreifuss muscular dystrophy) antikoerper, bocksbeutel antikoerper, emerin L homeolog antikoerper, emerin S homeolog antikoerper, EMD antikoerper, emd antikoerper, bocks antikoerper, emd.L antikoerper, emd.S antikoerper, Emd antikoerper

Hintergrund: Emerin is a serine-rich nuclear membrane protein that in humans is encoded by the EMD gene. And this gene is mapped to Xq28. Emerin is a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Emery-Dreifuss muscular dystrophy is an X-linked inherited degenerative myopathy resulting from mutation in the EMD (also known clinically as STA) gene. Emerin appears to be involved in mechanotransduction, as emerin-deficient mouse fibroblasts failed to transduce normal mechanosensitive gene expression responses to strain stimuli. In cardiac muscle, emerin is also found complexed to beta-catenin at adherens junctions of intercalated discs, and cardiomyocytes from hearts lacking emerin showed beta-catenin redistribution as well as perturbed intercalated disc architecture and myocyte shape. This interaction appears to be regulated by glycogen synthase kinase 3 beta.

Synonyms: EDMD | Emd | Emerin | LEMD5 | STA | P50402

Gen-ID: 2010

UniProt: P50402